PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID SapurV1A.0127s0010.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Salicaceae; Saliceae; Salix
Family NAC
Protein Properties Length: 377aa    MW: 41835.2 Da    PI: 8.8541
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
SapurV1A.0127s0010.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM171.42.9e-53431701128
                     NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatg 87 
                             lppGfrFhPtdeelvv+yLkkk+++ +l++  +i+evd+yk++Pw+Lp+k++ +e+ewyfFs+rd+ky++g r+nra++sgyWkatg
  SapurV1A.0127s0010.1.p  43 LPPGFRFHPTDEELVVHYLKKKTTSAPLPV-AIIAEVDLYKFDPWELPAKATFGEQEWYFFSPRDRKYPNGARPNRAATSGYWKATG 128
                             79****************************.88***************988899********************************* PP

                     NAM  88 kdkevlsk.kgelvglkktLvfykgrapkgektdWvmheyrl 128
                             +dk++l+  ++++vg+kk Lvfy g+ pkg kt+W+mheyrl
  SapurV1A.0127s0010.1.p 129 TDKPILTLgGTQKVGVKKALVFYGGKPPKGIKTNWIMHEYRL 170
                             *****99867888***************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019412.22E-6439204IPR003441NAC domain
PROSITE profilePS5100561.69143204IPR003441NAC domain
PfamPF023655.4E-2844170IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 377 aa     Download sequence    Send to blast
MLSDNKPSKS SQDSSNSPLY QLMESTDSST GGAGGGGSQQ PNLPPGFRFH PTDEELVVHY  60
LKKKTTSAPL PVAIIAEVDL YKFDPWELPA KATFGEQEWY FFSPRDRKYP NGARPNRAAT  120
SGYWKATGTD KPILTLGGTQ KVGVKKALVF YGGKPPKGIK TNWIMHEYRL TDNKLRNKPP  180
GCDLGIKKNS LRLDDWVLCR IYKKINTQRP IDHDKDDSMD DMLGSIPPSI LVGSHQNETN  240
HPAKGTNYGT LLDKDHNLFE GIISSNDGIF RSSSSMSRVA SPVSKPDHLH MLPLKRTLPS  300
LYWTDEDMAF PSSSKRFQGD INGDESVVRT DGNSSIVTLL SQLPQTSQLH QQTMLGSMGD  360
GIFRPPYQIP DMNWYS*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4dul_B3e-734020414165NAC domain-containing protein 19
4dul_A3e-734020414165NAC domain-containing protein 19
1ut7_B3e-734020414165NO APICAL MERISTEM PROTEIN
1ut7_A3e-734020414165NO APICAL MERISTEM PROTEIN
1ut4_B3e-734020414165NO APICAL MERISTEM PROTEIN
1ut4_A3e-734020414165NO APICAL MERISTEM PROTEIN
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002316919.20.0no apical meristem family protein
SwissprotQ9LD441e-120NAC56_ARATH; NAC transcription factor 56
TrEMBLB9HZY60.0B9HZY6_POPTR; No apical meristem family protein
STRINGPOPTR_0011s12420.10.0(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF16233498
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G15510.11e-110NAC domain containing protein 2